Loading...
Statistics
Advertisement

Antony Woodley Real Estate Agent Marshall White
www.antony-woodley.com/
Antony Woodley (0421 286 741). Real Estate Agent Marshall White. Antony Woodley's love for his job has carried the award winning auctioneer throu

Antony-woodley.com

Advertisement
Antony-woodley.com is hosted in Australia / Sydney . Antony-woodley.com doesn't use HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 5. First javascripts: Modernizr.js, Jquery.js, Foundation.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.4.7 (Ubuntu).

Technologies in use by Antony-woodley.com

Technology

Number of occurences: 7
  • CSS
  • Font Awesome
  • Html
  • Iframe
  • Javascript
  • jQuery
  • SVG

Advertisement

Javascripts

Number of occurences: 5
  • modernizr.js
  • jquery.js
  • foundation.min.js
  • slick.min.js
  • site.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.7 (Ubuntu)

Powered by

  • PHP/5.5.9-1ubuntu4.14

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Google Analytics ID

  • UA-62581251-1

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Antony-woodley.com

Missing HTTPS protocol.

    Meta - Antony-woodley.com

    Number of occurences: 10
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width, initial-scale=1.0
    • Name: description
      Content: Antony Woodley (0421 286 741). Real Estate Agent Marshall White. Antony Woodley's love for his job has carried the award winning auctioneer throu
    • Name: keywords
      Content: Antony Woodley, Real Estate Agent, estate agent, property agent, property sales, real estate sales, sell my property, sell my house, property appraisal, property values, sold property
    • Name: dc.language
      Content: AUS
    • Name: dc.source
      Content: http://www.antony-woodley.com
    • Name: dc.title
      Content: Antony Woodley Real Estate Agent Marshall White
    • Name: dc.keywords
      Content: Antony Woodley, Real Estate Agent, estate agent, property agent, property sales, real estate sales, sell my property, sell my house, property appraisal, property values, sold property
    • Name: dc.subject
      Content: Antony Woodley, Real Estate Agent, estate agent, property agent, property sales, real estate sales, sell my property, sell my house, property appraisal, property values, sold property
    • Name: dc.description
      Content: Antony Woodley (0421 286 741). Real Estate Agent Marshall White. Antony Woodley's love for his job has carried the award winning auctioneer throu

    Server / Hosting

    • IP: 113.192.44.153
    • Latitude: -33.86
    • Longitude: 151.20
    • Country: Australia
    • City: Sydney

    Rname

    • ns1.zonomi.com
    • ns2.zonomi.com

    Target

    • soacontact.zonomi.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Tue, 19 Apr 2016 04:52:06 GMT Server: Apache/2.4.7 (Ubuntu) Location: http://www.antony-woodley.com/ Content-Type: text/html; charset=iso-8859-1 HTTP/1.1 200 OK Date: Tue, 19 Apr 2016 04:52:07 GMT Server: Apache/2.4.7 (Ubuntu) X-Powered-By: PHP/5.5.9-1ubuntu4.14 Content-Type: text/html

    DNS

    host: antony-woodley.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 113.192.44.153
    host: antony-woodley.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.zonomi.com
    host: antony-woodley.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.zonomi.com
    host: antony-woodley.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.zonomi.com
    5. rname: soacontact.zonomi.com
    6. serial: 9
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ntony-woodley.com, www.aontony-woodley.com, www.ontony-woodley.com, www.apntony-woodley.com, www.pntony-woodley.com, www.a9ntony-woodley.com, www.9ntony-woodley.com, www.antony-woodley.com, www.ntony-woodley.com, www.aintony-woodley.com, www.intony-woodley.com, www.auntony-woodley.com, www.untony-woodley.com, www.atony-woodley.com, www.anntony-woodley.com, www.antony-woodley.com, www.anhtony-woodley.com, www.ahtony-woodley.com, www.anjtony-woodley.com, www.ajtony-woodley.com, www.anktony-woodley.com, www.aktony-woodley.com, www.anltony-woodley.com, www.altony-woodley.com, www.an tony-woodley.com, www.a tony-woodley.com, www.anony-woodley.com, www.antqony-woodley.com, www.anqony-woodley.com, www.antaony-woodley.com, www.anaony-woodley.com, www.ant ony-woodley.com, www.an ony-woodley.com, www.antwony-woodley.com, www.anwony-woodley.com, www.anteony-woodley.com, www.aneony-woodley.com, www.antzony-woodley.com, www.anzony-woodley.com, www.antxony-woodley.com, www.anxony-woodley.com, www.antcony-woodley.com, www.ancony-woodley.com, www.antny-woodley.com, www.antobny-woodley.com, www.antbny-woodley.com, www.antohny-woodley.com, www.anthny-woodley.com, www.antogny-woodley.com, www.antgny-woodley.com, www.antojny-woodley.com, www.antjny-woodley.com, www.antomny-woodley.com, www.antmny-woodley.com, www.anto ny-woodley.com, www.ant ny-woodley.com, www.antovny-woodley.com, www.antvny-woodley.com, www.antoy-woodley.com, www.antonny-woodley.com, www.antony-woodley.com, www.antonhy-woodley.com, www.antohy-woodley.com, www.antonjy-woodley.com, www.antojy-woodley.com, www.antonky-woodley.com, www.antoky-woodley.com, www.antonly-woodley.com, www.antoly-woodley.com, www.anton y-woodley.com, www.anto y-woodley.com, www.anton-woodley.com, www.antonyz-woodley.com, www.antonz-woodley.com, www.antonya-woodley.com, www.antona-woodley.com, www.antonys-woodley.com, www.antons-woodley.com, www.antonyd-woodley.com, www.antond-woodley.com, www.antony-woodley.com, www.anton-woodley.com, www.antonyc-woodley.com, www.antonc-woodley.com, www.antony -woodley.com, www.anton -woodley.com, www.antonywoodley.com, www.antony-twoodley.com, www.antonytwoodley.com, www.antony-gwoodley.com, www.antonygwoodley.com, www.antony-hwoodley.com, www.antonyhwoodley.com, www.antony-uwoodley.com, www.antonyuwoodley.com, www.antony-jwoodley.com, www.antonyjwoodley.com, www.antony-xwoodley.com, www.antonyxwoodley.com, www.antony-swoodley.com, www.antonyswoodley.com, www.antony-awoodley.com, www.antonyawoodley.com, www.antony-woodley.com, www.antonywoodley.com, www.antony- woodley.com, www.antony woodley.com, www.antony-oodley.com, www.antony-w oodley.com, www.antony- oodley.com, www.antony-wcoodley.com, www.antony-coodley.com, www.antony-woodley.com, www.antony-oodley.com, www.antony-wdoodley.com, www.antony-doodley.com, www.antony-wfoodley.com, www.antony-foodley.com, www.antony-wgoodley.com, www.antony-goodley.com, www.antony-wboodley.com, www.antony-boodley.com, www.antony-wodley.com, www.antony-wobodley.com, www.antony-wbodley.com, www.antony-wohodley.com, www.antony-whodley.com, www.antony-wogodley.com, www.antony-wgodley.com, www.antony-wojodley.com, www.antony-wjodley.com, www.antony-womodley.com, www.antony-wmodley.com, www.antony-wo odley.com, www.antony-w odley.com, www.antony-wovodley.com, www.antony-wvodley.com, www.antony-wodley.com, www.antony-woobdley.com, www.antony-wobdley.com, www.antony-woohdley.com, www.antony-wohdley.com, www.antony-woogdley.com, www.antony-wogdley.com, www.antony-woojdley.com, www.antony-wojdley.com, www.antony-woomdley.com, www.antony-womdley.com, www.antony-woo dley.com, www.antony-wo dley.com, www.antony-woovdley.com, www.antony-wovdley.com, www.antony-wooley.com, www.antony-woodtley.com, www.antony-wootley.com, www.antony-woodgley.com, www.antony-woogley.com, www.antony-woodbley.com, www.antony-woobley.com, www.antony-woodxley.com, www.antony-wooxley.com, www.antony-woodsley.com, www.antony-woosley.com, www.antony-woodfley.com, www.antony-woofley.com, www.antony-woodvley.com, www.antony-woovley.com, www.antony-woodyley.com, www.antony-wooyley.com, www.antony-woodzley.com, www.antony-woozley.com, www.antony-woodaley.com, www.antony-wooaley.com, www.antony-woodeley.com, www.antony-wooeley.com, www.antony-woodrley.com, www.antony-woorley.com,

    Other websites we recently analyzed

    1. ULKUCU HACKTEAM
      Brea (United States) - 64.90.40.14
      Server software: Apache
      Technology: CSS, Google Font API, Html, Javascript, Php, SVG, Wordpress
      Number of Javascript: 1
      Number of meta tags: 4
    2. Service4Logistic
      Poland - 79.96.238.137
      Server software: IdeaWebServer/v0.80
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 2
      Number of meta tags: 4
    3. cnfocus
      Beijing (China) - 114.113.158.13
      Server software: Apache/2.2.8 (Win32) PHP/5.2.6
      Technology: CSS, Html, Php
      Number of Javascript: 2
      Number of meta tags: 2
    4. 拉索城堡官方网站
      拉索城堡-----世界因我而不同,官方客服电话:4006-120-289。1
      Central District (Hong Kong) - 121.127.234.105
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 3
      Number of meta tags: 3
    5. iri.hs.kr
      Korea, Republic of - 211.210.30.141
      Server software:
      Technology: Javascript
    6. saltlakevalleycarpetcleaning.info
      Scottsdale (United States) - 184.168.221.42
      Server software:
      Technology: Html, Html5, Iframe
    7. Zenfolio | JL Photo & Design
      Jessica Lingenfelter Photography & Design provides graphic design work and artistic pictures and portraits with a modern and vintage flair. See our website for portfolios and pricing. Located in Neosho, MO.
      Europe - 95.100.248.121
      Server software:
      Technology: CSS, Google Font API, Html, Html5, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    8. maplelab
      Italy - 92.223.209.197
      Server software: Microsoft-IIS/7.5
      Technology: Html, Javascript, Google Analytics
      Number of meta tags: 2
    9. Дом здоровья "Оберег"
      Дом здоровья "Оберег"
      Russian Federation - 185.42.12.3
      Server software: nginx/1.0.15
      Technology: Carousel, CSS, Html, Javascript, jQuery, Php, LiveInternet counter
      Number of Javascript: 8
      Number of meta tags: 4
    10. MMM Investments
      India - 103.241.181.75
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Html

    Check Other Websites